SCOPe 2.03: Domain d3qnba_: 3qnb A:

Lineage for d3qnba_ (3qnb A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:668369] [189787] (1 PDB entry)

8. Domain d3qnba_: 3qnb A: [184532]
   automated match to d1e4dc_
   complexed with edo, so4

Details for d3qnba_

PDB Entry: 3qnb, 1.95 Å

PDB Description: crystal structure of an engineered oxa-10 variant with carbapenemase activity, oxa-10loop24

PDB Compounds: (A:) Oxacillinase

SCOPe Domain Sequences for d3qnba_:

Sequence; same for both SEQRES and ATOM records:

>d3qnba_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 668369]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgwgmgvtpqvgwwvgwveketevyffafnmdidnesklplrksiptkimesegi
ig

Timeline for d3qnba_:

• d3qnba_ first appeared in SCOPe 2.01
  
• d3qnba_ appears in SCOPe 2.02
  
• d3qnba_ appears in SCOPe 2.04
  
• d3qnba_ appears in the current release, SCOPe 2.08