SCOPe 2.03: Domain d3qk8d_: 3qk8 D:

Lineage for d3qk8d_ (3qk8 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [189638] (3 PDB entries)

8. Domain d3qk8d_: 3qk8 D: [184461]
   automated match to d1wz8a1
   complexed with cl, edo, unl

Details for d3qk8d_

PDB Entry: 3qk8, 1.6 Å

PDB Description: crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand

PDB Compounds: (D:) Enoyl-CoA hydratase EchA15

SCOPe Domain Sequences for d3qk8d_:

Sequence; same for both SEQRES and ATOM records:

>d3qk8d_ c.14.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
yqdfpslrfepgehgvlnlvldspglnsvgpqmhrdladvwpvidrdpdvrvvlvrgegk
afssggsfelidetigdyegririmreardlvlnlvnldkpvvsairgpavgaglvvall
adisvasatakiidghtklgvaagdhaaicwpllvgmakakyylltcetlsgeeaerigl
vstcvdddevlptatrlaenlaqgaqnairwtkrslnhwyrmfgptfetslgleflgftg
pdvqeglaahrqkrparft

Timeline for d3qk8d_:

• d3qk8d_ first appeared in SCOPe 2.01
  
• d3qk8d_ appears in SCOPe 2.02
  
• d3qk8d_ appears in SCOPe 2.04
  
• d3qk8d_ appears in the current release, SCOPe 2.08