Lineage for d3pvug_ (3pvu G:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505912Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1506012Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 1506013Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 1506014Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 1506015Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)
  8. 1506025Domain d3pvug_: 3pvu G: [184020]
    Other proteins in same PDB: d3pvua1, d3pvua2, d3pvua3, d3pvub_
    automated match to d1omwg_
    complexed with qrw

Details for d3pvug_

PDB Entry: 3pvu (more details), 2.48 Å

PDB Description: Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3pvug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvug_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

SCOPe Domain Coordinates for d3pvug_:

Click to download the PDB-style file with coordinates for d3pvug_.
(The format of our PDB-style files is described here.)

Timeline for d3pvug_: