Lineage for d3pulb_ (3pul B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444586Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)
  8. 2444600Domain d3pulb_: 3pul B: [183979]
    automated match to d1dhpa_
    complexed with act, gol, lys, so4

Details for d3pulb_

PDB Entry: 3pul (more details), 2.3 Å

PDB Description: Crystal structure of the complex of Dhydrodipicolinate synthase from Acinetobacter baumannii with lysine at 2.3A resolution
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pulb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pulb_ c.1.10.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

SCOPe Domain Coordinates for d3pulb_:

Click to download the PDB-style file with coordinates for d3pulb_.
(The format of our PDB-style files is described here.)

Timeline for d3pulb_: