Lineage for d1tfb_1 (1tfb 111-207)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99168Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 99169Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 99220Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)
  6. 99221Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)
  7. 99227Species Human (Homo sapiens) [TaxId:9606] [47967] (3 PDB entries)
  8. 99240Domain d1tfb_1: 1tfb 111-207 [18382]

Details for d1tfb_1

PDB Entry: 1tfb (more details)

PDB Description: nmr studies of human general transcription factor tfiib: dynamics and interaction with vp16 activation domain, 20 structures

SCOP Domain Sequences for d1tfb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfb_1 a.74.1.2 (111-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens)}
srammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrq
egvprtfkeicavsriskkeigrcfklilkaletsvd

SCOP Domain Coordinates for d1tfb_1:

Click to download the PDB-style file with coordinates for d1tfb_1.
(The format of our PDB-style files is described here.)

Timeline for d1tfb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfb_2