SCOPe 2.03: Domain d3pibb_: 3pib B:

Lineage for d3pibb_ (3pib B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)

8. Domain d3pibb_: 3pib B: [183772]
   automated match to d1uisa_
   complexed with gol

Details for d3pibb_

PDB Entry: 3pib, 1.15 Å

PDB Description: Crystal structure of red fluorescent protein eqFP578 crystallized at pH 5.5

PDB Compounds: (B:) eqFP578 fluorescent protein

SCOPe Domain Sequences for d3pibb_:

Sequence; same for both SEQRES and ATOM records:

>d3pibb_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
hhhhhhgsselikenmhmklymegtvnnhhfkctsegegkpyegtqtmkikvveggplpf
afdilatsfmygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqng
ciiynvkingvnfpsngsvmqkktlgweantemlypadgglrghsqmalklvgggylhcs
fkttyrskkpaknlkmpgfhfvdhrlerikeadketyveqhemavakycdlpsklghr

Timeline for d3pibb_:

• d3pibb_ first appeared in SCOPe 2.01
  
• d3pibb_ appears in SCOPe 2.02
  
• d3pibb_ appears in SCOPe 2.04
  
• d3pibb_ appears in the current release, SCOPe 2.08, called d3pibb1