SCOPe 2.07: Domain d3p6ha1: 3p6h A:0-131

Lineage for d3p6ha1 (3p6h A:0-131)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110275] (25 PDB entries)
   Uniprot P15090

8. Domain d3p6ha1: 3p6h A:0-131 [183555]
   Other proteins in same PDB: d3p6ha2
   automated match to d1toua_
   complexed with ibp

Details for d3p6ha1

PDB Entry: 3p6h, 1.15 Å

PDB Description: Human adipocyte lipid-binding protein FABP4 in complex with (S)-ibuprofen

PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d3p6ha1:

Sequence; same for both SEQRES and ATOM records:

>d3p6ha1 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

Timeline for d3p6ha1:

• d3p6ha1 first appeared in SCOPe 2.01, called d3p6ha_
  
• d3p6ha1 appears in SCOPe 2.06
  
• d3p6ha1 appears in the current release, SCOPe 2.08