SCOPe 2.07: Domain d3ovna_: 3ovn A:

Lineage for d3ovna_ (3ovn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)

8. Domain d3ovna_: 3ovn A: [183318]
   automated match to d1bi4c_
   protein/DNA complex; complexed with cd, mpv, so4, suc

Details for d3ovna_

PDB Entry: 3ovn, 1.95 Å

PDB Description: fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3ovna_:

Sequence, based on SEQRES records:

>d3ovna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records):

>d3ovna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipesmnkelkkiigqvrdqaehlktavqmavfihn
hkrkggiggysagerivdiiatd

Timeline for d3ovna_:

• d3ovna_ first appeared in SCOPe 2.01
  
• d3ovna_ appears in SCOPe 2.06
  
• d3ovna_ appears in the current release, SCOPe 2.08