Lineage for d3ohud_ (3ohu D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552682Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. 2552703Domain d3ohud_: 3ohu D: [183038]
    Other proteins in same PDB: d3ohua2
    automated match to d1r28a_

Details for d3ohud_

PDB Entry: 3ohu (more details), 2.1 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form I
PDB Compounds: (D:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohud_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgq
tkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl

SCOPe Domain Coordinates for d3ohud_:

Click to download the PDB-style file with coordinates for d3ohud_.
(The format of our PDB-style files is described here.)

Timeline for d3ohud_: