Lineage for d1bmfe1 (1bmf E:358-474)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154205Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 154206Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 154207Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 154208Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 154212Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 154235Domain d1bmfe1: 1bmf E:358-474 [18285]
    Other proteins in same PDB: d1bmfa2, d1bmfa3, d1bmfb2, d1bmfb3, d1bmfc2, d1bmfc3, d1bmfd2, d1bmfd3, d1bmfe2, d1bmfe3, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmfe1

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase
PDB Compounds: (E:)

SCOP Domain Sequences for d1bmfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfe1 a.69.1.1 (E:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1bmfe1:

Click to download the PDB-style file with coordinates for d1bmfe1.
(The format of our PDB-style files is described here.)

Timeline for d1bmfe1: