Lineage for d3nwvc_ (3nwv C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257365Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1257467Species Human (Homo sapiens) [TaxId:9606] [109644] (4 PDB entries)
    Uniprot P99999
  8. 1257478Domain d3nwvc_: 3nwv C: [182595]
    automated match to d1j3sa_
    complexed with hem

Details for d3nwvc_

PDB Entry: 3nwv (more details), 1.9 Å

PDB Description: human cytochrome c g41s
PDB Compounds: (C:) cytochrome c

SCOPe Domain Sequences for d3nwvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nwvc_ a.3.1.1 (C:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d3nwvc_:

Click to download the PDB-style file with coordinates for d3nwvc_.
(The format of our PDB-style files is described here.)

Timeline for d3nwvc_: