SCOPe 2.07: Domain d3nmkb_: 3nmk B:

Lineage for d3nmkb_ (3nmk B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (63 PDB entries)

8. Domain d3nmkb_: 3nmk B: [182404]
   automated match to d1qq3a_
   complexed with hem, pxx, zn

Details for d3nmkb_

PDB Entry: 3nmk, 2.8 Å

PDB Description: Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, MBP-Phen2

PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d3nmkb_:

Sequence; same for both SEQRES and ATOM records:

>d3nmkb_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3nmkb_:

• d3nmkb_ first appeared in SCOPe 2.01
  
• d3nmkb_ appears in SCOPe 2.06
  
• d3nmkb_ appears in the current release, SCOPe 2.08