Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
Protein Cytochrome b562 [47177] (1 species) |
Species Escherichia coli [TaxId:562] [47178] (63 PDB entries) |
Domain d3nmkb_: 3nmk B: [182404] automated match to d1qq3a_ complexed with hem, pxx, zn |
PDB Entry: 3nmk (more details), 2.8 Å
SCOPe Domain Sequences for d3nmkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nmkb_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]} adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
Timeline for d3nmkb_: