Lineage for d3nida_ (3nid A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418991Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2418992Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2418993Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2418994Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
    Uniprot P08514 32-483
  8. 2418998Domain d3nida_: 3nid A: [182316]
    Other proteins in same PDB: d3nidf1, d3nidf2, d3nidl1, d3nidl2
    automated match to d1tyea_
    complexed with ca, gol, mg, nag, so4

Details for d3nida_

PDB Entry: 3nid (more details), 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d3nida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nida_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d3nida_:

Click to download the PDB-style file with coordinates for d3nida_.
(The format of our PDB-style files is described here.)

Timeline for d3nida_: