Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries) |
Domain d3nf0a_: 3nf0 A: [182216] automated match to d1g7ka_ complexed with mlt |
PDB Entry: 3nf0 (more details), 1.75 Å
SCOPe Domain Sequences for d3nf0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nf0a_ d.22.1.1 (A:) automated matches {Discosoma sp. [TaxId: 301246]} evikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk pvqlpgayktdtklditshnedytiveqyernegrhstga
Timeline for d3nf0a_: