Lineage for d3nf0a_ (3nf0 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407645Protein automated matches [190406] (14 species)
    not a true protein
  7. 1407786Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries)
  8. 1407791Domain d3nf0a_: 3nf0 A: [182216]
    automated match to d1g7ka_
    complexed with mlt

Details for d3nf0a_

PDB Entry: 3nf0 (more details), 1.75 Å

PDB Description: mplum-ttn
PDB Compounds: (A:) Fluorescent protein plum

SCOPe Domain Sequences for d3nf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nf0a_ d.22.1.1 (A:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgayktdtklditshnedytiveqyernegrhstga

SCOPe Domain Coordinates for d3nf0a_:

Click to download the PDB-style file with coordinates for d3nf0a_.
(The format of our PDB-style files is described here.)

Timeline for d3nf0a_: