Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (31 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [189996] (3 PDB entries) |
Domain d3nd5f_: 3nd5 F: [182161] automated match to d1gn8a_ |
PDB Entry: 3nd5 (more details), 2.3 Å
SCOPe Domain Sequences for d3nd5f_:
Sequence, based on SEQRES records: (download)
>d3nd5f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]} mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll aeepyahvsssllkevlrfggdvsdylppniyhalkqk
>d3nd5f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]} mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya hvsssllkevlrfggdvsdylppniyhalkqk
Timeline for d3nd5f_: