Lineage for d3n7aw_ (3n7a W:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588434Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1588435Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1588548Protein automated matches [190071] (5 species)
    not a true protein
  7. 1588581Species Mycobacterium tuberculosis [TaxId:1773] [189947] (10 PDB entries)
  8. 1588629Domain d3n7aw_: 3n7a W: [181975]
    automated match to d1h05a_
    complexed with fa1, gol

Details for d3n7aw_

PDB Entry: 3n7a (more details), 2 Å

PDB Description: Crystal structure of 3-dehydroquinate dehydratase from Mycobacterium tuberculosis in complex with inhibitor 2
PDB Compounds: (W:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n7aw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7aw_ c.23.13.1 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d3n7aw_:

Click to download the PDB-style file with coordinates for d3n7aw_.
(The format of our PDB-style files is described here.)

Timeline for d3n7aw_: