Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species) contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450) |
Species Pseudomonas sp. [TaxId:320855] [189497] (11 PDB entries) |
Domain d3n20a_: 3n20 A: [181830] Other proteins in same PDB: d3n20b_, d3n20c_ automated match to d1t0qa_ complexed with fe, gol, p6g; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 3n20 (more details), 1.9 Å
SCOPe Domain Sequences for d3n20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n20a_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas sp. [TaxId: 320855]} smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm trdsvavsimltfafetgfvnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley egrlyhfgseadrwcfqidperyenhtnlvdrflkgeiqpadlagalmymslepgvmgdd ahdyewvkayq
Timeline for d3n20a_: