SCOPe 2.04: Domain d3n1qa_: 3n1q A:

Lineage for d3n1qa_ (3n1q A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
   automatically mapped to Pfam PF01085

6. Protein automated matches [190324] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188953] (16 PDB entries)

8. Domain d3n1qa_: 3n1q A: [181799]
   Other proteins in same PDB: d3n1qc_, d3n1qd_, d3n1qf_
   automated match to d1vhha_
   complexed with ca, zn

Details for d3n1qa_

PDB Entry: 3n1q, 2.89 Å

PDB Description: Crystal Structure of DhhN bound to CDOFn3

PDB Compounds: (A:) Desert hedgehog protein

SCOPe Domain Sequences for d3n1qa_:

Sequence; same for both SEQRES and ATOM records:

>d3n1qa_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
ygllarlaveagfdwvyyesrnhvhvsvkad

Timeline for d3n1qa_:

• d3n1qa_ first appeared in SCOPe 2.01
  
• d3n1qa_ appears in SCOPe 2.03
  
• d3n1qa_ appears in SCOPe 2.05
  
• d3n1qa_ appears in the current release, SCOPe 2.08