Lineage for d3n1ga_ (3n1g A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419023Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1419024Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 1419029Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 1419042Protein automated matches [190324] (2 species)
    not a true protein
  7. 1419043Species Human (Homo sapiens) [TaxId:9606] [188953] (15 PDB entries)
  8. 1419052Domain d3n1ga_: 3n1g A: [181783]
    Other proteins in same PDB: d3n1gc_, d3n1gd_
    automated match to d1vhha_
    complexed with ca, mg, zn

Details for d3n1ga_

PDB Entry: 3n1g (more details), 1.9 Å

PDB Description: Crystal structure of DhhN bound to BOCFn3
PDB Compounds: (A:) Desert hedgehog protein

SCOPe Domain Sequences for d3n1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n1ga_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
ygllarlaveagfdwvyyesrnhvhvsvkad

SCOPe Domain Coordinates for d3n1ga_:

Click to download the PDB-style file with coordinates for d3n1ga_.
(The format of our PDB-style files is described here.)

Timeline for d3n1ga_: