SCOPe 2.03: Domain d3n1fc_: 3n1f C:

Lineage for d3n1fc_ (3n1f C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (16 PDB entries)

8. Domain d3n1fc_: 3n1f C: [181781]
   Other proteins in same PDB: d3n1fa_, d3n1fb_
   automated match to d1x4ya1
   complexed with ca, zn

Details for d3n1fc_

PDB Entry: 3n1f, 1.6 Å

PDB Description: Crystal Structure of IhhN bound to CDOFn3

PDB Compounds: (C:) Cell adhesion molecule-related/down-regulated by oncogenes

SCOPe Domain Sequences for d3n1fc_:

Sequence, based on SEQRES records:

>d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyipssnnntpiqgfyiyyrptdsdndsdykrdvvegs
kqwhmighlqpetsydikmqcfneggesefsnvmicetk

Sequence, based on observed residues (ATOM records):

>d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pitgphiayteavsdtqimlkwtyiptpiqgfyiyyrptdsdndsdykrdvvegskqwhm
ighlqpetsydikmqcfneggesefsnvmicetk

Timeline for d3n1fc_:

• d3n1fc_ first appeared in SCOPe 2.01
  
• d3n1fc_ appears in SCOPe 2.02
  
• d3n1fc_ appears in SCOPe 2.04
  
• d3n1fc_ appears in the current release, SCOPe 2.08