SCOPe 2.07: Domain d3mxdb_: 3mxd B:

Lineage for d3mxdb_ (3mxd B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)

8. Domain d3mxdb_: 3mxd B: [181662]
   automated match to d1kzka_
   complexed with act, k53, po4

Details for d3mxdb_

PDB Entry: 3mxd, 1.95 Å

PDB Description: crystal structure of hiv-1 protease inhibitor kc53 in complex with wild-type protease

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d3mxdb_:

Sequence; same for both SEQRES and ATOM records:

>d3mxdb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3mxdb_:

• d3mxdb_ first appeared in SCOPe 2.01
  
• d3mxdb_ appears in SCOPe 2.06
  
• d3mxdb_ appears in the current release, SCOPe 2.08