SCOPe 2.04: Domain d3mv4o_: 3mv4 O:

Lineage for d3mv4o_ (3mv4 O:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries)

8. Domain d3mv4o_: 3mv4 O: [181581]
   Other proteins in same PDB: d3mv4a_, d3mv4b_, d3mv4c_
   automated match to d1ykmb1
   complexed with bme, co3, fe, gol, so4; mutant

Details for d3mv4o_

PDB Entry: 3mv4, 1.59 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase

PDB Compounds: (O:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3mv4o_:

Sequence; same for both SEQRES and ATOM records:

>d3mv4o_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

Timeline for d3mv4o_:

• d3mv4o_ first appeared in SCOPe 2.01
  
• d3mv4o_ appears in SCOPe 2.03
  
• d3mv4o_ appears in SCOPe 2.05
  
• d3mv4o_ appears in the current release, SCOPe 2.08