![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries) |
![]() | Domain d3mmtc1: 3mmt C:1-340 [181429] Other proteins in same PDB: d3mmta2, d3mmtb2, d3mmtc2, d3mmtd2 automated match to d1j4ea_ complexed with 2fp |
PDB Entry: 3mmt (more details), 2.35 Å
SCOPe Domain Sequences for d3mmtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmtc1 c.1.10.0 (C:1-340) automated matches {Bartonella henselae [TaxId: 38323]} mnerledialtlvgagkgilaadestatigkrfesigvectednrrayremlftakeame saisgvilfdetlrqkastgqmltdlirdagavpgikvdtgakplaafpqetitegldgl rerlkdyytlgarfakwraviaidaqtlptrgaisqnaqalaryaalcqeaglvpivepe vlmdgpsrqhsitrcfevtkvvlhtvfkelfearvlfegmilkpnmvidgkdariasvee vaektvhvlkqtvpaavpgiaflsggqtdeeatahlsamnalgalpwkltfsygralqaa alkawagknenivvaqkafchrarmnhlaalgqwtkdqek
Timeline for d3mmtc1: