Lineage for d3mjla_ (3mjl A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2481854Protein Arginase [52770] (5 species)
  7. 2481886Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries)
    Uniprot P05089 5-313
  8. 2481948Domain d3mjla_: 3mjl A: [181300]
    automated match to d1wvaa1
    complexed with 2ai, mn

Details for d3mjla_

PDB Entry: 3mjl (more details), 1.9 Å

PDB Description: crystal structure of human arginase i in complex with 2- aminoimidazole. resolution 1.90 a.
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d3mjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjla_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

SCOPe Domain Coordinates for d3mjla_:

Click to download the PDB-style file with coordinates for d3mjla_.
(The format of our PDB-style files is described here.)

Timeline for d3mjla_: