Lineage for d3mita_ (3mit A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422754Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2422755Protein automated matches [190516] (5 species)
    not a true protein
  7. 2422765Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)
  8. 2422782Domain d3mita_: 3mit A: [181289]
    automated match to d1c3ka_
    complexed with hez, man, zn

Details for d3mita_

PDB Entry: 3mit (more details), 2.32 Å

PDB Description: structure of banana lectin-alpha-d-mannose complex
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3mita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mita_ b.77.3.0 (A:) automated matches {Musa acuminata [TaxId: 4641]}
aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
ffgrggdfidaigvylep

SCOPe Domain Coordinates for d3mita_:

Click to download the PDB-style file with coordinates for d3mita_.
(The format of our PDB-style files is described here.)

Timeline for d3mita_: