Lineage for d3mi0o_ (3mi0 O:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439456Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1439473Domain d3mi0o_: 3mi0 O: [181253]
    automated match to d1q5qa_
    complexed with dmf, sa6

Details for d3mi0o_

PDB Entry: 3mi0 (more details), 2.2 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome at 2.2 A
PDB Compounds: (O:) Proteasome subunit alpha

SCOPe Domain Sequences for d3mi0o_:

Sequence, based on SEQRES records: (download)

>d3mi0o_ d.153.1.4 (O:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
alragsadtsggdqptlgvaslevavldanrprrafrritgsalqall

Sequence, based on observed residues (ATOM records): (download)

>d3mi0o_ d.153.1.4 (O:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
alralgvaslevavldanrprrafrritgsalqall

SCOPe Domain Coordinates for d3mi0o_:

Click to download the PDB-style file with coordinates for d3mi0o_.
(The format of our PDB-style files is described here.)

Timeline for d3mi0o_: