SCOPe 2.04: Domain d3mh9a_: 3mh9 A:

Lineage for d3mh9a_ (3mh9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.0: automated matches [191645] (1 protein)
   not a true family

6. Protein automated matches [191184] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189449] (3 PDB entries)

8. Domain d3mh9a_: 3mh9 A: [181218]
   automated match to d2byoa1
   mutant

Details for d3mh9a_

PDB Entry: 3mh9, 1.79 Å

PDB Description: crystal structure of lprg mutant v91w from mycobacterium tuberculosis

PDB Compounds: (A:) Lipoprotein lprG

SCOPe Domain Sequences for d3mh9a_:

Sequence; same for both SEQRES and ATOM records:

>d3mh9a_ b.125.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnwklt
lggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadaka
egrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsg
nsvqmtlskwgekvqvtkppvsklh

Timeline for d3mh9a_:

• d3mh9a_ first appeared in SCOPe 2.01
  
• d3mh9a_ appears in SCOPe 2.03
  
• d3mh9a_ appears in SCOPe 2.05
  
• d3mh9a_ appears in the current release, SCOPe 2.08, called d3mh9a1