Class b: All beta proteins [48724] (176 folds) |
Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily) 11 stranded sheet partly folded in a corner-like structure filled with a few short helices |
Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) |
Family b.125.1.0: automated matches [191645] (1 protein) not a true family |
Protein automated matches [191184] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189449] (3 PDB entries) |
Domain d3mh9a_: 3mh9 A: [181218] automated match to d2byoa1 mutant |
PDB Entry: 3mh9 (more details), 1.79 Å
SCOPe Domain Sequences for d3mh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mh9a_ b.125.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ggplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnwklt lggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadaka egrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsg nsvqmtlskwgekvqvtkppvsklh
Timeline for d3mh9a_: