Lineage for d3mgrc_ (3mgr C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482600Protein Histone H2A [47115] (6 species)
  7. 1482601Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)
  8. 1482614Domain d3mgrc_: 3mgr C: [181202]
    Other proteins in same PDB: d3mgra_, d3mgrb_, d3mgrd_, d3mgre_, d3mgrf_, d3mgrh_
    automated match to d1kx5c_
    protein/DNA complex; complexed with cl, mn, rb

Details for d3mgrc_

PDB Entry: 3mgr (more details), 2.3 Å

PDB Description: binding of rubidium ions to the nucleosome core particle
PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d3mgrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgrc_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3mgrc_:

Click to download the PDB-style file with coordinates for d3mgrc_.
(The format of our PDB-style files is described here.)

Timeline for d3mgrc_: