SCOP 1.73: Domain d2ezba1: 2ezb A:22-144

Lineage for d2ezba1 (2ezb A:22-144)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family)

5. Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)

6. Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
   inserted in the phosphohistidine domain

7. Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)

8. Domain d2ezba1: 2ezb A:22-144 [18114]
   Other proteins in same PDB: d2ezba2

Details for d2ezba1

PDB Entry: 2ezb

PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 14 structures

PDB Compounds: (A:) phosphotransferase system, enzyme I

SCOP Domain Sequences for d2ezba1:

Sequence; same for both SEQRES and ATOM records:

>d2ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

Timeline for d2ezba1:

• d2ezba1 first appeared (with stable ids) in SCOP 1.55, called d2ezb_1
  
• d2ezba1 was called d2ezb_1 in SCOP 1.71
  
• d2ezba1 appears in SCOP 1.75
  
• d2ezba1 appears in the current release, SCOPe 2.08