Lineage for d2ezb_1 (2ezb 22-144)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) 
Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) 
Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) 
Domain d2ezb_1: 2ezb 22-144 [18114]
Other proteins in same PDB: d2ezb_2
Details for d2ezb_1
PDB Entry: 2ezb (more details)
PDB Description: amino terminal domain of enzyme i from escherichia coli, nmr, 14 structures
SCOP Domain Sequences for d2ezb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezb_1 a.60.10.1 (22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl
SCOP Domain Coordinates for d2ezb_1:
Click to download the PDB-style file with coordinates for d2ezb_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ezb_1:
- d2ezb_1 appears in SCOP 1.57
- d2ezb_1 appears in the current release, SCOPe 2.08, called d2ezba1
View in 3D
