Lineage for d1cf6a1 (1cf6 A:10-91)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4346Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family) (S)
  5. 4347Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein)
  6. 4348Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 4440Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (9 PDB entries)
  8. 4441Domain d1cf6a1: 1cf6 A:10-91 [18071]
    Other proteins in same PDB: d1cf6a2, d1cf6b2

Details for d1cf6a1

PDB Entry: 1cf6 (more details), 3.1 Å

PDB Description: structure of dna polymerase beta/dna template-primer/utp phosphonate intermediate complex--potential insight into the molecular basis of fidelity

SCOP Domain Sequences for d1cf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf6a1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOP Domain Coordinates for d1cf6a1:

Click to download the PDB-style file with coordinates for d1cf6a1.
(The format of our PDB-style files is described here.)

Timeline for d1cf6a1:

  • d1cf6a1 does not appear in SCOP 1.57

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf6a2