Lineage for d3lr9a_ (3lr9 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474677Species Horse (Equus caballus) [TaxId:9796] [46474] (65 PDB entries)
  8. 1474702Domain d3lr9a_: 3lr9 A: [180524]
    automated match to d1azia_
    complexed with hem, no2, so4

Details for d3lr9a_

PDB Entry: 3lr9 (more details), 1.55 Å

PDB Description: X-ray photogenerated ferrous horse heart myoglobin, nitrite adduct
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3lr9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lr9a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d3lr9a_:

Click to download the PDB-style file with coordinates for d3lr9a_.
(The format of our PDB-style files is described here.)

Timeline for d3lr9a_: