Lineage for d3lnya_ (3lny A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538600Protein Phosphatase hPTP1e [50168] (2 species)
  7. 1538601Species Human (Homo sapiens) [TaxId:9606] [50169] (7 PDB entries)
  8. 1538602Domain d3lnya_: 3lny A: [180435]
    automated match to d1d5ga_
    complexed with scn, so4

Details for d3lnya_

PDB Entry: 3lny (more details), 1.3 Å

PDB Description: second pdz domain from human ptp1e in complex with ra-gef2 peptide
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d3lnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnya_ b.36.1.1 (A:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqs

SCOPe Domain Coordinates for d3lnya_:

Click to download the PDB-style file with coordinates for d3lnya_.
(The format of our PDB-style files is described here.)

Timeline for d3lnya_: