Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Phosphatase hPTP1e [50168] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50169] (7 PDB entries) |
Domain d3lnya_: 3lny A: [180435] automated match to d1d5ga_ complexed with scn, so4 |
PDB Entry: 3lny (more details), 1.3 Å
SCOPe Domain Sequences for d3lnya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnya_ b.36.1.1 (A:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]} pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla vngvslegathkqavetlrntgqvvhlllekgqs
Timeline for d3lnya_: