SCOPe 2.07: Domain d3lmej1: 3lme J:30-156

Lineage for d3lmej1 (3lme J:30-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (19 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [189252] (1 PDB entry)

8. Domain d3lmej1: 3lme J:30-156 [180390]
   Other proteins in same PDB: d3lmea2, d3lmeb2, d3lmec2, d3lmed2, d3lmee2, d3lmef2, d3lmeg2, d3lmeh2, d3lmei2, d3lmej2, d3lmek2, d3lmel2
   automated match to d2cwja1
   complexed with so4

Details for d3lmej1

PDB Entry: 3lme, 2.74 Å

PDB Description: structure of probable translation initiation inhibitor from (rpa2473) from rhodopseudomonas palustris

PDB Compounds: (J:) Possible translation initiation inhibitor

SCOPe Domain Sequences for d3lmej1:

Sequence; same for both SEQRES and ATOM records:

>d3lmej1 d.79.1.0 (J:30-156) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
kiiaptdktitpsgtwsigaragdfvfiggmhgtdrvtgkmvdgdearirrmfdnmlaaa
eaagatkadavrltvfvtdvakyrpvvnkvqkdiwgdgpypprtvlqvpaldqgdiaeid
gtfyapa

Timeline for d3lmej1:

• d3lmej1 first appeared in SCOPe 2.01, called d3lmej_
  
• d3lmej1 appears in SCOPe 2.06
  
• d3lmej1 appears in the current release, SCOPe 2.08