Class g: Small proteins [56992] (91 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries) |
Domain d3l4oc_: 3l4o C: [179940] Other proteins in same PDB: d3l4od_, d3l4of_ automated match to d1mg2b_ complexed with 1pe, act, ca, hec, pg4 |
PDB Entry: 3l4o (more details), 2.05 Å
SCOPe Domain Sequences for d3l4oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4oc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3l4oc_: