SCOPe 2.07: Domain d3kxna_: 3kxn A:

Lineage for d3kxna_ (3kxn A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (34 PDB entries)

8. Domain d3kxna_: 3kxn A: [179795]
   automated match to d1dawa_
   complexed with k8x

Details for d3kxna_

PDB Entry: 3kxn, 2 Å

PDB Description: crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor tetraiodobenzimidazole (k88)

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3kxna_:

Sequence; same for both SEQRES and ATOM records:

>d3kxna_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

Timeline for d3kxna_:

• d3kxna_ first appeared in SCOPe 2.01
  
• d3kxna_ appears in SCOPe 2.06
  
• d3kxna_ appears in the current release, SCOPe 2.08