SCOPe 2.04: Domain d3krra_: 3krr A:

Lineage for d3krra_ (3krr A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)

8. Domain d3krra_: 3krr A: [179623]
   automated match to d1u54a_
   complexed with dqx

Details for d3krra_

PDB Entry: 3krr, 1.8 Å

PDB Description: Crystal Structure of JAK2 complexed with a potent quinoxaline ATP site inhibitor

PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d3krra_:

Sequence; same for both SEQRES and ATOM records:

>d3krra_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfere
ieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyts
qickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespi
fwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhl
iellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma

Timeline for d3krra_:

• d3krra_ first appeared in SCOPe 2.01
  
• d3krra_ appears in SCOPe 2.03
  
• d3krra_ appears in SCOPe 2.05
  
• d3krra_ appears in the current release, SCOPe 2.08, called d3krra1