Lineage for d1coka_ (1cok A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272207Protein C-terminal domain of p73 [47779] (1 species)
  7. 1272208Species Human (Homo sapiens) [TaxId:9606] [47780] (2 PDB entries)
  8. 1272210Domain d1coka_: 1cok A: [17945]

Details for d1coka_

PDB Entry: 1cok (more details)

PDB Description: structure of the c-terminal domain of p73
PDB Compounds: (A:) protein (second splice variant p73)

SCOPe Domain Sequences for d1coka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coka_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]}
yhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglq
dlkqghdy

SCOPe Domain Coordinates for d1coka_:

Click to download the PDB-style file with coordinates for d1coka_.
(The format of our PDB-style files is described here.)

Timeline for d1coka_: