SCOPe 2.04: Domain d3kj1a_: 3kj1 A:

Lineage for d3kj1a_ (3kj1 A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (34 PDB entries)

8. Domain d3kj1a_: 3kj1 A: [179392]
   automated match to d1wsxa_
   complexed with act, cl, zn; mutant

Details for d3kj1a_

PDB Entry: 3kj1, 1.95 Å

PDB Description: mcl-1 in complex with bim bh3 mutant i2da

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d3kj1a_:

Sequence; same for both SEQRES and ATOM records:

>d3kj1a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdelyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqg
mlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepl
aesitdvlvrtkrdwlvkqrgwdgfveffhve

Timeline for d3kj1a_:

• d3kj1a_ first appeared in SCOPe 2.01
  
• d3kj1a_ appears in SCOPe 2.03
  
• d3kj1a_ appears in SCOPe 2.05
  
• d3kj1a_ appears in the current release, SCOPe 2.08, called d3kj1a1