Lineage for d3kgwa_ (3kgw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613596Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1613784Protein automated matches [190399] (9 species)
    not a true protein
  7. 1613817Species Mouse (Mus musculus) [TaxId:10090] [189108] (2 PDB entries)
  8. 1613818Domain d3kgwa_: 3kgw A: [179364]
    automated match to d1h0ca_
    complexed with cl, edo, plp

Details for d3kgwa_

PDB Entry: 3kgw (more details), 1.65 Å

PDB Description: crystal structure of putative aminotransferase (aah25799.1) from mus musculus at 1.65 a resolution
PDB Compounds: (A:) Alanine-glyoxylate aminotransferase

SCOPe Domain Sequences for d3kgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kgwa_ c.67.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qllvpppealskplsvptrlllgpgpsnlaprvlaagslrmighmqkemlqimeeikqgi
qyvfqtrnpltlvvsgsghcametalfnllepgdsfltgtngiwgmraaeiadrigarvh
qmikkpgehytlqeveeglaqhkpvllflvhgesstgvvqpldgfgelchryqclllvds
vaslggvpiymdqqgidimysssqkvlnappgislisfndkakykvysrktkpvsfytdi
tylaklwgcegetrvihhttpvtslyclreslaliaeqglencwrrhreatahlhkhlqe
mglkffvkdpeirlptittvtvpagynwrdivsyvldhfsieisgglgpteervlrigll
gynattenvdrvaealrealqhcpkn

SCOPe Domain Coordinates for d3kgwa_:

Click to download the PDB-style file with coordinates for d3kgwa_.
(The format of our PDB-style files is described here.)

Timeline for d3kgwa_: