Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189108] (2 PDB entries) |
Domain d3kgwa_: 3kgw A: [179364] automated match to d1h0ca_ complexed with cl, edo, plp |
PDB Entry: 3kgw (more details), 1.65 Å
SCOPe Domain Sequences for d3kgwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kgwa_ c.67.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qllvpppealskplsvptrlllgpgpsnlaprvlaagslrmighmqkemlqimeeikqgi qyvfqtrnpltlvvsgsghcametalfnllepgdsfltgtngiwgmraaeiadrigarvh qmikkpgehytlqeveeglaqhkpvllflvhgesstgvvqpldgfgelchryqclllvds vaslggvpiymdqqgidimysssqkvlnappgislisfndkakykvysrktkpvsfytdi tylaklwgcegetrvihhttpvtslyclreslaliaeqglencwrrhreatahlhkhlqe mglkffvkdpeirlptittvtvpagynwrdivsyvldhfsieisgglgpteervlrigll gynattenvdrvaealrealqhcpkn
Timeline for d3kgwa_: