Lineage for d3k6cg_ (3k6c G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317066Family a.25.1.5: half-ferritin [140450] (1 protein)
    comprise of alpha-hairpin subunits forming the ferritin-like four-helical bundle; assembles further in a homodecamer
  6. 2317067Protein Hypothetical protein NE0167 [140451] (1 species)
  7. 2317068Species Nitrosomonas europaea [TaxId:915] [140452] (2 PDB entries)
    Uniprot Q82XT5 4-94
  8. 2317085Domain d3k6cg_: 3k6c G: [179125]
    automated match to d3k6ca_

Details for d3k6cg_

PDB Entry: 3k6c (more details), 2.2 Å

PDB Description: crystal structure of protein ne0167 from nitrosomonas europaea
PDB Compounds: (G:) Uncharacterized protein NE0167

SCOPe Domain Sequences for d3k6cg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6cg_ a.25.1.5 (G:) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]}
ndgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeeke
haamllewirrcdpafdkelkdylftnkpia

SCOPe Domain Coordinates for d3k6cg_:

Click to download the PDB-style file with coordinates for d3k6cg_.
(The format of our PDB-style files is described here.)

Timeline for d3k6cg_: