Lineage for d3k48a_ (3k48 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2387221Protein automated matches [190204] (3 species)
    not a true protein
  7. 2387262Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries)
  8. 2387264Domain d3k48a_: 3k48 A: [179059]
    automated match to d1u5xa_

Details for d3k48a_

PDB Entry: 3k48 (more details), 2.8 Å

PDB Description: Crystal structure of APRIL bound to a peptide
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 13

SCOPe Domain Sequences for d3k48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k48a_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

SCOPe Domain Coordinates for d3k48a_:

Click to download the PDB-style file with coordinates for d3k48a_.
(The format of our PDB-style files is described here.)

Timeline for d3k48a_: