Lineage for d3jqmb_ (3jqm B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561313Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2561319Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2561320Protein automated matches [190706] (6 species)
    not a true protein
  7. 2561343Species Thermus thermophilus HB8 [TaxId:300852] [187852] (5 PDB entries)
  8. 2561371Domain d3jqmb_: 3jqm B: [178699]
    automated match to d1ekra_
    complexed with edo, flc, gol, gtp, peg

Details for d3jqmb_

PDB Entry: 3jqm (more details), 2.5 Å

PDB Description: Binding of 5'-GTP to molybdenum cofactor biosynthesis protein MoaC from Thermus theromophilus HB8
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d3jqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jqmb_ d.58.21.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad
liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlk
aaskglvisqvrllhkaggksgewrr

SCOPe Domain Coordinates for d3jqmb_:

Click to download the PDB-style file with coordinates for d3jqmb_.
(The format of our PDB-style files is described here.)

Timeline for d3jqmb_: