Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein AMPC beta-Lactamase, class C [56618] (3 species) contains small alpha+beta subdomain inserted in the common fold |
Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (73 PDB entries) |
Domain d3iwib_: 3iwi B: [178649] automated match to d1c3ba_ complexed with po4; mutant |
PDB Entry: 3iwi (more details), 1.64 Å
SCOPe Domain Sequences for d3iwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwib_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhaaavspgaldaeaygvkstiedmarwvqsnlkp ldinektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvka itpptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnal q
Timeline for d3iwib_: