Lineage for d3iwib_ (3iwi B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450076Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1450095Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (73 PDB entries)
  8. 1450129Domain d3iwib_: 3iwi B: [178649]
    automated match to d1c3ba_
    complexed with po4; mutant

Details for d3iwib_

PDB Entry: 3iwi (more details), 1.64 Å

PDB Description: X-ray crystal structure of the extended-spectrum AmpC omega loop insertion (H210AAA) mutant beta-lactamase at 1.64 Angstrom resolution
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3iwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwib_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhaaavspgaldaeaygvkstiedmarwvqsnlkp
ldinektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvka
itpptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnal
q

SCOPe Domain Coordinates for d3iwib_:

Click to download the PDB-style file with coordinates for d3iwib_.
(The format of our PDB-style files is described here.)

Timeline for d3iwib_: