Lineage for d3iira_ (3iir A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402021Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2402169Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2402170Protein automated matches [190445] (10 species)
    not a true protein
  7. 2402229Species Murraya koenigii [TaxId:311449] [189153] (3 PDB entries)
  8. 2402232Domain d3iira_: 3iir A: [178337]
    automated match to d1r8na_

Details for d3iira_

PDB Entry: 3iir (more details), 2.9 Å

PDB Description: Crystal Structure of Miraculin like protein from seeds of Murraya koenigii
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d3iira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iira_ b.42.4.0 (A:) automated matches {Murraya koenigii [TaxId: 311449]}
dplldingnvveasrdyylvsviggaggggltlyrgrnelcpldviqlspdlhkgtrlrf
aaynntsiiheavdlnvkfstetscneptvwrvdnydpsrgkwfittggvegnpgaqtlk
nwfklervgtdqgtyeivhcpsvckscvflcndvgvsydyrrrlaltagnervfgvvivp
anegsascvs

SCOPe Domain Coordinates for d3iira_:

Click to download the PDB-style file with coordinates for d3iira_.
(The format of our PDB-style files is described here.)

Timeline for d3iira_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3iirb_