Lineage for d3igxa1 (3igx A:1-321)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444917Species Francisella tularensis [TaxId:177416] [189018] (3 PDB entries)
  8. 2444921Domain d3igxa1: 3igx A:1-321 [178319]
    Other proteins in same PDB: d3igxa2
    automated match to d1onra_
    complexed with po4

Details for d3igxa1

PDB Entry: 3igx (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis.
PDB Compounds: (A:) Transaldolase

SCOPe Domain Sequences for d3igxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igxa1 c.1.10.0 (A:1-321) automated matches {Francisella tularensis [TaxId: 177416]}
mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskv
kannpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriia
ryesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvsp
fvgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvial
agcdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathkla
egirlftkdtieleniikqnl

SCOPe Domain Coordinates for d3igxa1:

Click to download the PDB-style file with coordinates for d3igxa1.
(The format of our PDB-style files is described here.)

Timeline for d3igxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3igxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3igxb_