SCOPe 2.03: Domain d3iaca_: 3iac A:

Lineage for d3iaca_ (3iac A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189010] (1 PDB entry)

8. Domain d3iaca_: 3iac A: [178206]
   automated match to d1j5sa_
   complexed with cl

Details for d3iaca_

PDB Entry: 3iac, 2.22 Å

PDB Description: 2.2 angstrom crystal structure of glucuronate isomerase from salmonella typhimurium.

PDB Compounds: (A:) Glucuronate isomerase

SCOPe Domain Sequences for d3iaca_:

Sequence; same for both SEQRES and ATOM records:

>d3iaca_ c.1.9.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
atfmtedfllkndiartlyhkyaapmpiydfhchlspqeiaddrrfdnlgqiwlegdhyk
wralrsagvdeslitgketsdyekymawantvpktlgnplyhwthlelrrpfgitgtlfg
pdtaesiwtqcneklatpafsargimqqmnvrmvgttddpidsleyhrqiaaddsidiev
apswrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaacgcrasdhg
ietlrfapvpddaqldailgkrlagetlseleiaqfttavlvwlgrqyaargwvmqlhig
airnnntrmfrllgpdtgfdsigdnniswalsrlldsmdvtnelpktilyclnprdnevl
atmignfqgpgiagkvqfgsgwwfndqkdgmlrqleqlsqmgllsqfvgmltdsrsflsy
trheyfrrilcnllgqwaqdgeipddeamlsrmvqdicfnnaqryftik

Timeline for d3iaca_:

• d3iaca_ first appeared in SCOPe 2.01
  
• d3iaca_ appears in SCOPe 2.02
  
• d3iaca_ appears in SCOPe 2.04
  
• d3iaca_ appears in the current release, SCOPe 2.08