Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (16 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189010] (1 PDB entry) |
Domain d3iaca_: 3iac A: [178206] automated match to d1j5sa_ complexed with cl |
PDB Entry: 3iac (more details), 2.22 Å
SCOPe Domain Sequences for d3iaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaca_ c.1.9.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} atfmtedfllkndiartlyhkyaapmpiydfhchlspqeiaddrrfdnlgqiwlegdhyk wralrsagvdeslitgketsdyekymawantvpktlgnplyhwthlelrrpfgitgtlfg pdtaesiwtqcneklatpafsargimqqmnvrmvgttddpidsleyhrqiaaddsidiev apswrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaacgcrasdhg ietlrfapvpddaqldailgkrlagetlseleiaqfttavlvwlgrqyaargwvmqlhig airnnntrmfrllgpdtgfdsigdnniswalsrlldsmdvtnelpktilyclnprdnevl atmignfqgpgiagkvqfgsgwwfndqkdgmlrqleqlsqmgllsqfvgmltdsrsflsy trheyfrrilcnllgqwaqdgeipddeamlsrmvqdicfnnaqryftik
Timeline for d3iaca_: