Lineage for d3i9pb_ (3i9p B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526416Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1526417Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1526886Protein automated matches [190376] (1 species)
    not a true protein
  7. 1526887Species Human (Homo sapiens) [TaxId:9606] [187223] (5 PDB entries)
  8. 1526899Domain d3i9pb_: 3i9p B: [178187]
    automated match to d1bzda_

Details for d3i9pb_

PDB Entry: 3i9p (more details), 1.9 Å

PDB Description: Crystal structure of human transthyretin - wild type
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3i9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9pb_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d3i9pb_:

Click to download the PDB-style file with coordinates for d3i9pb_.
(The format of our PDB-style files is described here.)

Timeline for d3i9pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i9pa_