SCOPe 2.07: Domain d3i8rc_: 3i8r C:

Lineage for d3i8rc_ (3i8r C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d3i8rc_: 3i8r C: [178148]
   automated match to d1iw1a_
   complexed with dtv, hem, so4

Details for d3i8rc_

PDB Entry: 3i8r, 1.5 Å

PDB Description: Crystal structure of the heme oxygenase from Corynebacterium diphtheriae (HmuO) in complex with heme binding ditiothreitol (DTT)

PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d3i8rc_:

Sequence; same for both SEQRES and ATOM records:

>d3i8rc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d3i8rc_:

• d3i8rc_ first appeared in SCOPe 2.01
  
• d3i8rc_ appears in SCOPe 2.06
  
• d3i8rc_ appears in the current release, SCOPe 2.08