SCOPe 2.04: Domain d3ho0a_: 3ho0 A:

Lineage for d3ho0a_ (3ho0 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [48525] (85 PDB entries)
   Uniprot P37231 232-505

8. Domain d3ho0a_: 3ho0 A: [177723]
   automated match to d1nyxa_
   protein/DNA complex; complexed with dkd

Details for d3ho0a_

PDB Entry: 3ho0, 2.6 Å

PDB Description: Crystal structure of the PPARgamma-LBD complexed with a new aryloxy-3phenylpropanoic acid

PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3ho0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ho0a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Timeline for d3ho0a_:

• d3ho0a_ first appeared in SCOPe 2.01
  
• d3ho0a_ appears in SCOPe 2.03
  
• d3ho0a_ appears in SCOPe 2.05
  
• d3ho0a_ appears in the current release, SCOPe 2.08